# Domain Price Buy Now
1 madeforcreativity.com Accepting Offers Inquire
2 theskipass.com Accepting Offers Inquire
3 roundhardrock.com Accepting Offers Inquire
4 copypastedays.com Accepting Offers Inquire
5 solacemedicalcannabis.com Accepting Offers Inquire
6 livehopeinspire.com Accepting Offers Inquire
7 ever-documents.com Accepting Offers Inquire
8 strengthtrainingoutlet.com Accepting Offers Inquire
9 wheatbasket.com Accepting Offers Inquire
10 pickyourplaces.com Accepting Offers Inquire
11 cowboysbucketlistadventures.com Accepting Offers Inquire
12 wejoyboutique.com Accepting Offers Inquire
13 traversecityimplants.com Accepting Offers Inquire
14 visually-dope.com Accepting Offers Inquire
15 wemakeyouhealthy.com Accepting Offers Inquire
16 jungleflyfish.com Accepting Offers Inquire
17 mattent.com Accepting Offers Inquire
18 yesvine.com Accepting Offers Inquire
19 fishescloud.com Accepting Offers Inquire
20 dexteritymedia.com Accepting Offers Inquire
21 oakcreekcottage.com Accepting Offers Inquire
22 goparlour.com Accepting Offers Inquire
23 hugefungaming.com Accepting Offers Inquire
24 inhighlandvillage.com Accepting Offers Inquire
25 hi-mr-mrs.com Accepting Offers Inquire
26 indiadiscoverytours.com Accepting Offers Inquire
27 citysamplerexperience.com Accepting Offers Inquire
28 bunfilms.com Accepting Offers Inquire
29 wet-works.com Accepting Offers Inquire
30 fatsremedy.com Accepting Offers Inquire
31 topdenverbusinesscoaching.com Accepting Offers Inquire
32 favourmate.com Accepting Offers Inquire
33 crystalmecrazy.com Accepting Offers Inquire
34 unitedmagicstitch.com Accepting Offers Inquire
35 mysuccessroadmap.com Accepting Offers Inquire
36 gratework.com Accepting Offers Inquire
37 lovesjet.com Accepting Offers Inquire
38 doublethedetails.com Accepting Offers Inquire
39 americainjuryattorney.com Accepting Offers Inquire
40 gamers-fist.com Accepting Offers Inquire
41 thesmokingraisin.com Accepting Offers Inquire
42 auroraestatesspain.com Accepting Offers Inquire
43 easykitesurf.com Accepting Offers Inquire
44 dropeveryfear.com Accepting Offers Inquire
45 dailysoulproject.com Accepting Offers Inquire
46 relaxsecurity-home.com Accepting Offers Inquire
47 silverfallsphoto.com Accepting Offers Inquire
48 tripsmemo.com Accepting Offers Inquire
49 hardlystrictlymusky.com Accepting Offers Inquire
50 deltasprung.com Accepting Offers Inquire
51 freeboppre.com Accepting Offers Inquire
52 marketingnewage.com Accepting Offers Inquire
53 kitchenandbathroomcabnets.com Accepting Offers Inquire
54 meaninghub.com Accepting Offers Inquire
55 smileitclear.com Accepting Offers Inquire
56 rewardcharters.com Accepting Offers Inquire
57 healthymodelact.com Accepting Offers Inquire
58 coopercapitalgroup.com Accepting Offers Inquire
59 internet-super-store.com Accepting Offers Inquire
60 sun-help.com Accepting Offers Inquire
61 crystalcolourstudio.com Accepting Offers Inquire
62 paessential.com Accepting Offers Inquire
63 agorachoice.com Accepting Offers Inquire
64 textscrap.com Accepting Offers Inquire
65 globalsourcedesign.com Accepting Offers Inquire
66 hawaiianfamilyhealthservices.com Accepting Offers Inquire
67 buttonmepretty.com Accepting Offers Inquire
68 bizbuzzin.com Accepting Offers Inquire
69 gluemobile.com Accepting Offers Inquire
70 goldenwestseniors.com Accepting Offers Inquire
71 pointmerge.com Accepting Offers Inquire
72 twinriverclub.com Accepting Offers Inquire
73 oneindiamart.com Accepting Offers Inquire
74 runsire.com Accepting Offers Inquire
75 crossingus.com Accepting Offers Inquire
76 secretnuclearlab.com Accepting Offers Inquire
77 laserpup.com Accepting Offers Inquire
78 bloomgrowblossom.com Accepting Offers Inquire
79 aimsbizsolutions.com Accepting Offers Inquire
80 informationtechnologyservicedesk.com Accepting Offers Inquire
81 clicknowto.com Accepting Offers Inquire
82 bike-game.com Accepting Offers Inquire
83 myfightfriend.com Accepting Offers Inquire
84 cafefinewine.com Accepting Offers Inquire
85 protectioncourse.com Accepting Offers Inquire
86 businessinsurancefinancial.com Accepting Offers Inquire
87 creativeox.com Accepting Offers Inquire
88 texttreat.com Accepting Offers Inquire
89 angrycomputerguy.com Accepting Offers Inquire
90 campclassflow.com Accepting Offers Inquire
91 forbookbox.com Accepting Offers Inquire
92 imagingdoctors.com Accepting Offers Inquire
93 makeminutesmatter.com Accepting Offers Inquire
94 ideapointhosting.com Accepting Offers Inquire
95 horizonwestnewhomeconsultant.com Accepting Offers Inquire
96 brooksidetransport.com Accepting Offers Inquire
97 beforeyoupark.com Accepting Offers Inquire
98 postmodernenterprises.com Accepting Offers Inquire
99 purelybygrace.com Accepting Offers Inquire
100 yourbodyloveswater.com Accepting Offers Inquire
101 consolidatednationalinfrastructure.com Accepting Offers Inquire
102 flirtingquotes.com Accepting Offers Inquire
103 tasteofchinaasian.com Accepting Offers Inquire
104 thespunbachelor.com Accepting Offers Inquire
105 yourfutureeducators.com Accepting Offers Inquire
106 tipsofthe-day.com Accepting Offers Inquire
107 houstonhouserelief.com Accepting Offers Inquire
108 loandepotfast.com Accepting Offers Inquire
109 bankofmetal.com Accepting Offers Inquire
110 broadwayforrent.com Accepting Offers Inquire
111 ferrytales-documentary.com Accepting Offers Inquire
112 spa-reflexology.com Accepting Offers Inquire
113 digitalageconsultant.com Accepting Offers Inquire
114 moveyouremotionalbaggageout.com Accepting Offers Inquire
115 mainstreammirror.com Accepting Offers Inquire
116 guestmyhome.com Accepting Offers Inquire
117 gobbleexpress.com Accepting Offers Inquire
118 expertdiagnosis.com Accepting Offers Inquire
119 lilacdirectory.com Accepting Offers Inquire
120 nomadgonads.com Accepting Offers Inquire
121 sales-generateleads.com Accepting Offers Inquire
122 ancientswag.com Accepting Offers Inquire
123 fourwingsphotobooth.com Accepting Offers Inquire
124 themindmadelife.com Accepting Offers Inquire
125 pudding-fairy.com Accepting Offers Inquire
126 teamminutesgaming.com Accepting Offers Inquire
127 leanagencyfatprofits.com Accepting Offers Inquire
128 goldenhandgame.com Accepting Offers Inquire
129 northcountyimportspecialist.com Accepting Offers Inquire
130 beautyuslife.com Accepting Offers Inquire
131 fasthostage.com Accepting Offers Inquire
132 sophisticatededit.com Accepting Offers Inquire
133 themostdeals.com Accepting Offers Inquire
134 not-news.com Accepting Offers Inquire
135 scanmystock.com Accepting Offers Inquire
136 orangecountytransportationservices.com Accepting Offers Inquire
137 skills-developer.com Accepting Offers Inquire
138 mynailappointment.com Accepting Offers Inquire
139 thehomebuyershelpline.com Accepting Offers Inquire
140 brainslotto.com Accepting Offers Inquire
141 leaarts.com Accepting Offers Inquire
142 soulangelsreadings.com Accepting Offers Inquire
143 halfthecanvas.com Accepting Offers Inquire
144 reliefbooking.com Accepting Offers Inquire
145 oraclemigrations.com Accepting Offers Inquire
146 wooferdata.com Accepting Offers Inquire
147 shipwithadmiral.com Accepting Offers Inquire
148 gamedesigncareer.com Accepting Offers Inquire
149 finnsmithwedding.com Accepting Offers Inquire
150 inthezonecamp.com Accepting Offers Inquire
151 psychiclog.com Accepting Offers Inquire
152 thebusinessofminimalism.com Accepting Offers Inquire
153 multiple-ways.com Accepting Offers Inquire
154 southernhospitalityoutfitters.com Accepting Offers Inquire
155 faithbasedcoaches.com Accepting Offers Inquire
156 dualgradientservices.com Accepting Offers Inquire
157 tannerleeconstruction.com Accepting Offers Inquire
158 smokingraisincellars.com Accepting Offers Inquire
159 truebluesac.com Accepting Offers Inquire
160 businessenglishbuzz.com Accepting Offers Inquire
161 hamvideos.com Accepting Offers Inquire
162 inkwrapsutah.com Accepting Offers Inquire
163 worldoffuture.com Accepting Offers Inquire
164 blazepowerbatteries.com Accepting Offers Inquire
165 hafranchise.com Accepting Offers Inquire
166 storypremise.com Accepting Offers Inquire
167 foodsmark.com Accepting Offers Inquire
168 sailinvoice.com Accepting Offers Inquire
169 rockitstartup.com Accepting Offers Inquire
170 heroflier.com Accepting Offers Inquire
171 true-hacks.com Accepting Offers Inquire
172 thinrunner.com Accepting Offers Inquire
173 modernmodish.com Accepting Offers Inquire
174 drivewayofdeath.com Accepting Offers Inquire
175 adelaidebesthandyman.com Accepting Offers Inquire
176 fetishpeep.com Accepting Offers Inquire
177 flyerfrank.com Accepting Offers Inquire
178 binauralsecret.com Accepting Offers Inquire
179 trust-in-change.com Accepting Offers Inquire
180 nastywomenconsulting.com Accepting Offers Inquire
181 millparkcounsellingcentre.com Accepting Offers Inquire
182 bodyandspiritessentialoils.com Accepting Offers Inquire
183 diamonddisplayanddesign.com Accepting Offers Inquire
184 millennialapartments.com Accepting Offers Inquire
185 connectingsuite.com Accepting Offers Inquire
186 normalstreetpainting.com Accepting Offers Inquire
187 fullcirclesproudparents.com Accepting Offers Inquire
188 hearing-aid-insights.com Accepting Offers Inquire
189 hikefinance.com Accepting Offers Inquire
190 naplesfloridasite.com Accepting Offers Inquire
191 myowngascard.com Accepting Offers Inquire
192 howlinggorilla.com Accepting Offers Inquire
193 autismtraininggroup.com Accepting Offers Inquire
194 flyingbicyclepicnics.com Accepting Offers Inquire
195 lakewoodstudio.com Accepting Offers Inquire
196 directhomeservices.com Accepting Offers Inquire
197 listnetworkguru.com Accepting Offers Inquire
198 globaltargetmarketing.com Accepting Offers Inquire
199 victory-times.com Accepting Offers Inquire
200 indiabigmarkit.com Accepting Offers Inquire
201 hasty-retreat.com Accepting Offers Inquire
202 computersanddesigns.com Accepting Offers Inquire
203 riveroaksnursing.com Accepting Offers Inquire
204 risebusinessbar.com Accepting Offers Inquire
205 myliveadviser.com Accepting Offers Inquire
206 make-that-call.com Accepting Offers Inquire
207 speed-ghost.com Accepting Offers Inquire
208 bankmortgageratestoday.com Accepting Offers Inquire
209 dualkeyinvestments.com Accepting Offers Inquire
210 wordtextbooks.com Accepting Offers Inquire
211 liberalcensorship.com Accepting Offers Inquire
212 coolhatmedia.com Accepting Offers Inquire
213 oureducationsavingsaccount.com Accepting Offers Inquire
214 onlytitansclothes.com Accepting Offers Inquire
215 lashboyfriend.com Accepting Offers Inquire
216 adult-cam-sex.com Accepting Offers Inquire
217 aeoncareer.com Accepting Offers Inquire
218 safe-internet-protection.com Accepting Offers Inquire
219 bulkgarlands.com Accepting Offers Inquire
220 sustainablyfed.com Accepting Offers Inquire
221 forgottenbonds.com Accepting Offers Inquire
222 fastlanecash.com Accepting Offers Inquire
223 kingfootawnings.com Accepting Offers Inquire
224 european-patriots.com Accepting Offers Inquire
225 meaningfulorganic.com Accepting Offers Inquire
226 marijuanaparadox.com Accepting Offers Inquire
227 myrockinbooty.com Accepting Offers Inquire
228 thevideotrainer.com Accepting Offers Inquire
229 brilliantparadise.com Accepting Offers Inquire
230 humansnotrefugees.com Accepting Offers Inquire
231 helpingfloridamoms.com Accepting Offers Inquire
232 justforkneat.com Accepting Offers Inquire
233 templatewholesaler.com Accepting Offers Inquire
234 theknightlyprogrammer.com Accepting Offers Inquire
235 tangofunds.com Accepting Offers Inquire
236 zanypath.com Accepting Offers Inquire
237 birdsestateagents.com Accepting Offers Inquire
238 facelancer.com Accepting Offers Inquire
239 holedugdeep.com Accepting Offers Inquire
240 thehealthyveganshow.com Accepting Offers Inquire
241 ridetoeducation.com Accepting Offers Inquire
242 greatfloridatreasurehunt.com Accepting Offers Inquire
243 skineternity.com Accepting Offers Inquire
244 uncommonleadershipspeaker.com Accepting Offers Inquire
245 autodealersamerica.com Accepting Offers Inquire
246 romanliquid.com Accepting Offers Inquire
247 glendalemusicschool.com Accepting Offers Inquire
248 thebibledetectiveseries.com Accepting Offers Inquire
249 idealcolts.com Accepting Offers Inquire
250 growthstrategyforums.com Accepting Offers Inquire